Search

Home / MyBioSource / Life Science Supplies
Recombinant Escherichia coli Outer membrane protein X (ompX) (Recombinant Protein) in Kuwait

Recombinant Escherichia coli Outer membrane protein X (ompX) (Recombinant Protein)

KWD 0

1 +

Special Features

  • GeneName: ompX; ECK0803; JW0799; ybiG
  • SynName: Recombinant Outer membrane protein X (ompX); Outer membrane protein X
  • outer membrane protein X; Outer membrane protein X
  • Source: E Coli or Yeast
  • Purity: >90%; *Tag Information: His tagged; *Species: Escherichia coli (strain K12)
  • Storage Buffer: PBS pH 7.4, 50% glycerol; *SeqPos: 24-171
  • Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
  • FREE-8GB-USBDrive for this item. Item is for research use. NOT for diagnostic/therapeutic procedure.

Description

*Form: This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.; *Seq: ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF; *Accession#: NP_415335.1; NC_000913.2; P0A917; *NCBI Summary: ompX is nduced by acid or base. [More information is available at EcoGene: EG12135]. OmpX is a small (18 kDa) outer-membrane protein (OMP). [More information is available at EcoCyc: EG12117].; *Uniprot Summary: Subcellular location: Cell outer membrane; Multi-pass membrane protein. Sequence similarities: Belongs to the Ail/OmpX/PagC/Lom family.

Related Items


{"error":"Error","cart_limit":"You have too many items in your cart.","prod_limit":"You cannot add any more of this item"}